PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C008548P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 291aa    MW: 32829 Da    PI: 6.7388
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C008548P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.4e-312276155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprl+Wt+eLH+rFveav+ LGG++kAtPk+++++m++ gL+l+h+kSHLQkYRl
  MELO3C008548P1 22 KPRLKWTHELHQRFVEAVNYLGGADKATPKSLMRVMGITGLSLYHLKSHLQKYRL 76
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-292078IPR009057Homeodomain-like
SuperFamilySSF466897.17E-162177IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-222277IPR006447Myb domain, plants
PfamPF002494.9E-72475IPR001005SANT/Myb domain
PfamPF143791.4E-19118165IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MQNHHHHQQQ PHMNLVLSTD AKPRLKWTHE LHQRFVEAVN YLGGADKATP KSLMRVMGIT  60
GLSLYHLKSH LQKYRLGKSQ QAETNAQVKL QEMQKKSGHF DGEENKDRTQ NQNKTENMKI  120
SEALEMQLQV QKRLQEQIEV QKHLQLKIEA QGKYLKIVLR KAQETIAGYG CCSEALEEAK  180
AELSQLASMV SSGCQSSCLS ELTDSTELSF KGTERVGSGR RMCSIESSLT SSETSEEAPT  240
TKKRKGNGKE KEKEESSSVC EEEEEEEEEL RMMDLNDTAI GFGSKLIQFL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818460.0LN681846.1 Cucumis melo genomic scaffold, anchoredscaffold00009.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008441712.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK55e-48APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0A0LJX41e-167A0A0A0LJX4_CUCSA; Uncharacterized protein
STRINGVIT_01s0026g02550.t011e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.25e-64G2-like family protein